Icon representing a puzzle

2197: Electron Density Reconstruction 12: Round 2

Closed since over 3 years ago

Novice Overall Electron Density

Summary

Created
September 08, 2022
Expires
Max points
100
Description

Since the previous Puzzle 2191 we've adjusted the starting structure to include a residue that is absent in the deposited structure. Players may not load solutions from the Puzzle 2191. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 13,645
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 13,173
  3. Avatar for RubiscoBobGroup 13. RubiscoBobGroup 1 pt. 13,072
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 12,693
  5. Avatar for Window Group 15. Window Group 1 pt. 8,487
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 0
  1. Avatar for AlkiP0Ps 41. AlkiP0Ps Lv 1 5 pts. 17,944
  2. Avatar for firejuggler 42. firejuggler Lv 1 4 pts. 17,877
  3. Avatar for ichwilldiesennamen 43. ichwilldiesennamen Lv 1 4 pts. 17,833
  4. Avatar for nspc 44. nspc Lv 1 3 pts. 17,747
  5. Avatar for alcor29 45. alcor29 Lv 1 3 pts. 17,741
  6. Avatar for fpc 46. fpc Lv 1 3 pts. 17,695
  7. Avatar for NinjaGreg 47. NinjaGreg Lv 1 3 pts. 17,681
  8. Avatar for Dr.Sillem 48. Dr.Sillem Lv 1 2 pts. 17,575
  9. Avatar for silent gene 49. silent gene Lv 1 2 pts. 17,536
  10. Avatar for carxo 50. carxo Lv 1 2 pts. 17,533

Comments

Sandrix72 Lv 1

I observed several sudden crashes of the new program. I use Win10. There are no error messages, and I cannot say yet if this is a bug related especially to this puzzle or not.
Recipe that was running before the crash: LR9