Icon representing a puzzle

2197: Electron Density Reconstruction 12: Round 2

Closed since over 3 years ago

Novice Overall Electron Density

Summary

Created
September 08, 2022
Expires
Max points
100
Description

Since the previous Puzzle 2191 we've adjusted the starting structure to include a residue that is absent in the deposited structure. Players may not load solutions from the Puzzle 2191. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 13,645
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 13,173
  3. Avatar for RubiscoBobGroup 13. RubiscoBobGroup 1 pt. 13,072
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 12,693
  5. Avatar for Window Group 15. Window Group 1 pt. 8,487
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 0
  1. Avatar for ProfVince 51. ProfVince Lv 1 2 pts. 17,396
  2. Avatar for bamh 52. bamh Lv 1 2 pts. 17,316
  3. Avatar for manu8170 53. manu8170 Lv 1 1 pt. 17,297
  4. Avatar for rezaefar 54. rezaefar Lv 1 1 pt. 17,057
  5. Avatar for Trajan464 55. Trajan464 Lv 1 1 pt. 17,010
  6. Avatar for Gonegirl 56. Gonegirl Lv 1 1 pt. 16,787
  7. Avatar for georg137 57. georg137 Lv 1 1 pt. 16,744
  8. Avatar for alyssa_d_V2.0 58. alyssa_d_V2.0 Lv 1 1 pt. 16,506
  9. Avatar for Wiz kid 59. Wiz kid Lv 1 1 pt. 16,316
  10. Avatar for Oransche 60. Oransche Lv 1 1 pt. 16,281

Comments

Sandrix72 Lv 1

I observed several sudden crashes of the new program. I use Win10. There are no error messages, and I cannot say yet if this is a bug related especially to this puzzle or not.
Recipe that was running before the crash: LR9