Icon representing a puzzle

2197: Electron Density Reconstruction 12: Round 2

Closed since over 3 years ago

Novice Overall Electron Density

Summary

Created
September 08, 2022
Expires
Max points
100
Description

Since the previous Puzzle 2191 we've adjusted the starting structure to include a residue that is absent in the deposited structure. Players may not load solutions from the Puzzle 2191. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 13,645
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 13,173
  3. Avatar for RubiscoBobGroup 13. RubiscoBobGroup 1 pt. 13,072
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 12,693
  5. Avatar for Window Group 15. Window Group 1 pt. 8,487
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 0
  1. Avatar for nnguye71 81. nnguye71 Lv 1 1 pt. 0
  2. Avatar for kerryemery@yahoo.com 82. kerryemery@yahoo.com Lv 1 1 pt. 0
  3. Avatar for phi16 83. phi16 Lv 1 1 pt. 0
  4. Avatar for rmoretti 84. rmoretti Lv 1 1 pt. 0
  5. Avatar for Tlaloc 85. Tlaloc Lv 1 1 pt. 0
  6. Avatar for LeoRampante 86. LeoRampante Lv 1 1 pt. 0

Comments

Sandrix72 Lv 1

I observed several sudden crashes of the new program. I use Win10. There are no error messages, and I cannot say yet if this is a bug related especially to this puzzle or not.
Recipe that was running before the crash: LR9