Icon representing a puzzle

2197: Electron Density Reconstruction 12: Round 2

Closed since over 3 years ago

Novice Novice Overall Overall Electron Density Electron Density

Summary


Created
September 08, 2022
Expires
Max points
100
Description

Since the previous Puzzle 2191 we've adjusted the starting structure to include a residue that is absent in the deposited structure. Players may not load solutions from the Puzzle 2191. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK

Top groups


  1. Avatar for Go Science 100 pts. 19,014
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 18,968
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 18,766
  4. Avatar for Contenders 4. Contenders 33 pts. 18,762
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 18,634
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 18,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 18,113
  8. Avatar for Australia 8. Australia 5 pts. 17,944
  9. Avatar for VeFold 9. VeFold 3 pts. 17,575
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 16,506

  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 19,002
  2. Avatar for LociOiling 2. LociOiling Lv 1 95 pts. 18,968
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 89 pts. 18,916
  4. Avatar for grogar7 4. grogar7 Lv 1 84 pts. 18,831
  5. Avatar for Galaxie 5. Galaxie Lv 1 79 pts. 18,803
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 74 pts. 18,779
  7. Avatar for g_b 7. g_b Lv 1 70 pts. 18,777
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 66 pts. 18,766
  9. Avatar for guineapig 9. guineapig Lv 1 62 pts. 18,762
  10. Avatar for MicElephant 10. MicElephant Lv 1 58 pts. 18,762

Comments


Sandrix72 Lv 1

I observed several sudden crashes of the new program. I use Win10. There are no error messages, and I cannot say yet if this is a bug related especially to this puzzle or not.
Recipe that was running before the crash: LR9