Icon representing a puzzle

2197: Electron Density Reconstruction 12: Round 2

Closed since over 3 years ago

Novice Overall Electron Density

Summary

Created
September 08, 2022
Expires
Max points
100
Description

Since the previous Puzzle 2191 we've adjusted the starting structure to include a residue that is absent in the deposited structure. Players may not load solutions from the Puzzle 2191. The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 19,014
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 18,968
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 18,766
  4. Avatar for Contenders 4. Contenders 33 pts. 18,762
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 18,634
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 18,623
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 18,113
  8. Avatar for Australia 8. Australia 5 pts. 17,944
  9. Avatar for VeFold 9. VeFold 3 pts. 17,575
  10. Avatar for Trinity Biology 10. Trinity Biology 2 pts. 16,506
  1. Avatar for zippyc137 11. zippyc137 Lv 1 54 pts. 18,762
  2. Avatar for Aubade01 12. Aubade01 Lv 1 51 pts. 18,753
  3. Avatar for ucad 13. ucad Lv 1 47 pts. 18,737
  4. Avatar for gmn 14. gmn Lv 1 44 pts. 18,736
  5. Avatar for jinhd6 15. jinhd6 Lv 1 41 pts. 18,641
  6. Avatar for infjamc 16. infjamc Lv 1 38 pts. 18,641
  7. Avatar for WBarme1234 17. WBarme1234 Lv 1 36 pts. 18,623
  8. Avatar for NPrincipi 18. NPrincipi Lv 1 33 pts. 18,623
  9. Avatar for BackBuffer 19. BackBuffer Lv 1 31 pts. 18,606
  10. Avatar for spmm 20. spmm Lv 1 29 pts. 18,600

Comments

Sandrix72 Lv 1

I observed several sudden crashes of the new program. I use Win10. There are no error messages, and I cannot say yet if this is a bug related especially to this puzzle or not.
Recipe that was running before the crash: LR9