Icon representing a puzzle

2206: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
September 29, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,089
  2. Avatar for Team China 12. Team China 1 pt. 9,722
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,679
  4. Avatar for RubiscoBobGroup 15. RubiscoBobGroup 1 pt. 9,608
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,746
  6. Avatar for Firesign 17. Firesign 1 pt. 8,717

  1. Avatar for Tomy 91. Tomy Lv 1 1 pt. 8,295
  2. Avatar for jeff101 92. jeff101 Lv 1 1 pt. 8,295
  3. Avatar for Silvercraft 93. Silvercraft Lv 1 1 pt. 8,295
  4. Avatar for laki2b 94. laki2b Lv 1 1 pt. 8,295
  5. Avatar for Charlie 95. Charlie Lv 1 1 pt. 8,295
  6. Avatar for FerredogDiesel 96. FerredogDiesel Lv 1 1 pt. 8,295
  7. Avatar for ChGat2022 97. ChGat2022 Lv 1 1 pt. 8,295

Comments