Icon representing a puzzle

2206: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 29, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,089
  2. Avatar for Team China 12. Team China 1 pt. 9,722
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,679
  4. Avatar for RubiscoBobGroup 15. RubiscoBobGroup 1 pt. 9,608
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,746
  6. Avatar for Firesign 17. Firesign 1 pt. 8,717

  1. Avatar for BackBuffer 11. BackBuffer Lv 1 58 pts. 11,475
  2. Avatar for MicElephant 12. MicElephant Lv 1 55 pts. 11,473
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 52 pts. 11,452
  4. Avatar for NPrincipi 14. NPrincipi Lv 1 49 pts. 11,383
  5. Avatar for Idiotboy 15. Idiotboy Lv 1 46 pts. 11,372
  6. Avatar for Pazithi 16. Pazithi Lv 1 43 pts. 11,372
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 41 pts. 11,366
  8. Avatar for g_b 18. g_b Lv 1 38 pts. 11,339
  9. Avatar for Vinara 19. Vinara Lv 1 36 pts. 11,286
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 34 pts. 11,258

Comments