Icon representing a puzzle

2206: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 29, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,089
  2. Avatar for Team China 12. Team China 1 pt. 9,722
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,679
  4. Avatar for BIOB101 - Discover Biology 14. BIOB101 - Discover Biology 1 pt. 9,678
  5. Avatar for RubiscoBobGroup 15. RubiscoBobGroup 1 pt. 9,608
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,746
  7. Avatar for Firesign 17. Firesign 1 pt. 8,717
  1. Avatar for ucad 21. ucad Lv 1 32 pts. 11,255
  2. Avatar for blazegeek 22. blazegeek Lv 1 30 pts. 11,252
  3. Avatar for guineapig 23. guineapig Lv 1 28 pts. 11,236
  4. Avatar for fpc 24. fpc Lv 1 26 pts. 11,224
  5. Avatar for fiendish_ghoul 25. fiendish_ghoul Lv 1 24 pts. 11,162
  6. Avatar for BootsMcGraw 26. BootsMcGraw Lv 1 23 pts. 11,146
  7. Avatar for maithra 27. maithra Lv 1 21 pts. 11,117
  8. Avatar for infjamc 28. infjamc Lv 1 20 pts. 11,099
  9. Avatar for heather-1 29. heather-1 Lv 1 18 pts. 11,077
  10. Avatar for ProfVince 30. ProfVince Lv 1 17 pts. 11,073

Comments