Icon representing a puzzle

2206: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 29, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,089
  2. Avatar for Team China 12. Team China 1 pt. 9,722
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,679
  4. Avatar for BIOB101 - Discover Biology 14. BIOB101 - Discover Biology 1 pt. 9,678
  5. Avatar for RubiscoBobGroup 15. RubiscoBobGroup 1 pt. 9,608
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,746
  7. Avatar for Firesign 17. Firesign 1 pt. 8,717
  1. Avatar for akaaka 31. akaaka Lv 1 16 pts. 11,064
  2. Avatar for bamh 32. bamh Lv 1 15 pts. 11,062
  3. Avatar for alcor29 33. alcor29 Lv 1 14 pts. 11,034
  4. Avatar for sallallami 34. sallallami Lv 1 13 pts. 11,027
  5. Avatar for SemperRabbit 35. SemperRabbit Lv 1 12 pts. 11,014
  6. Avatar for Alistair69 36. Alistair69 Lv 1 11 pts. 10,970
  7. Avatar for manu8170 37. manu8170 Lv 1 10 pts. 10,958
  8. Avatar for AlkiP0Ps 38. AlkiP0Ps Lv 1 9 pts. 10,951
  9. Avatar for phi16 39. phi16 Lv 1 9 pts. 10,893
  10. Avatar for zippyc137 40. zippyc137 Lv 1 8 pts. 10,873

Comments