Icon representing a puzzle

2206: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 29, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,089
  2. Avatar for Team China 12. Team China 1 pt. 9,722
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,679
  4. Avatar for BIOB101 - Discover Biology 14. BIOB101 - Discover Biology 1 pt. 9,678
  5. Avatar for RubiscoBobGroup 15. RubiscoBobGroup 1 pt. 9,608
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,746
  7. Avatar for Firesign 17. Firesign 1 pt. 8,717
  1. Avatar for stomjoh 41. stomjoh Lv 1 7 pts. 10,841
  2. Avatar for Trajan464 42. Trajan464 Lv 1 7 pts. 10,789
  3. Avatar for Crossed Sticks 43. Crossed Sticks Lv 1 6 pts. 10,700
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 6 pts. 10,678
  5. Avatar for argyrw 45. argyrw Lv 1 5 pts. 10,671
  6. Avatar for Oransche 46. Oransche Lv 1 5 pts. 10,665
  7. Avatar for Komeiji_Koishi 47. Komeiji_Koishi Lv 1 4 pts. 10,641
  8. Avatar for MrZanav 48. MrZanav Lv 1 4 pts. 10,634
  9. Avatar for hada 49. hada Lv 1 4 pts. 10,624
  10. Avatar for rezaefar 50. rezaefar Lv 1 3 pts. 10,590

Comments