Icon representing a puzzle

2206: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 29, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,089
  2. Avatar for Team China 12. Team China 1 pt. 9,722
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,679
  4. Avatar for RubiscoBobGroup 15. RubiscoBobGroup 1 pt. 9,608
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,746
  6. Avatar for Firesign 17. Firesign 1 pt. 8,717

  1. Avatar for MartinKorinek148 51. MartinKorinek148 Lv 1 3 pts. 10,578
  2. Avatar for BotError404 52. BotError404 Lv 1 3 pts. 10,572
  3. Avatar for Gonegirl 53. Gonegirl Lv 1 3 pts. 10,563
  4. Avatar for silent gene 54. silent gene Lv 1 2 pts. 10,514
  5. Avatar for Wiz kid 55. Wiz kid Lv 1 2 pts. 10,512
  6. Avatar for vybi 56. vybi Lv 1 2 pts. 10,475
  7. Avatar for CharaLilith 57. CharaLilith Lv 1 2 pts. 10,401
  8. Avatar for carxo 58. carxo Lv 1 2 pts. 10,394
  9. Avatar for Merf 59. Merf Lv 1 1 pt. 10,329
  10. Avatar for alyssa_d_V2.0 60. alyssa_d_V2.0 Lv 1 1 pt. 10,301

Comments