Icon representing a puzzle

2206: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 29, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 10,089
  2. Avatar for Team China 12. Team China 1 pt. 9,722
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,679
  4. Avatar for BIOB101 - Discover Biology 14. BIOB101 - Discover Biology 1 pt. 9,678
  5. Avatar for RubiscoBobGroup 15. RubiscoBobGroup 1 pt. 9,608
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,746
  7. Avatar for Firesign 17. Firesign 1 pt. 8,717
  1. Avatar for RubiscoBob 81. RubiscoBob Lv 1 1 pt. 9,608
  2. Avatar for copter15399 82. copter15399 Lv 1 1 pt. 9,526
  3. Avatar for 15959601368 83. 15959601368 Lv 1 1 pt. 8,971
  4. Avatar for bkoep 84. bkoep Lv 1 1 pt. 8,746
  5. Avatar for RegnadKcin 85. RegnadKcin Lv 1 1 pt. 8,717
  6. Avatar for agcohn821 86. agcohn821 Lv 1 1 pt. 8,432
  7. Avatar for oliviaanto 87. oliviaanto Lv 1 1 pt. 8,405
  8. Avatar for fifazaz715 88. fifazaz715 Lv 1 1 pt. 8,404
  9. Avatar for rmoretti 89. rmoretti Lv 1 1 pt. 8,295
  10. Avatar for spvincent 90. spvincent Lv 1 1 pt. 8,295

Comments