Icon representing a puzzle

2209: Electron Density Reconstruction 14

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
ITRTISKAKGPPRIPEVYLLPPPRNELSKKKVSLTCMITGFYPADINVEWDSSEPSDYKNTPPVFDTDGSFFLYSRLKVDTDAWNNGESFTCSVMHEALPNHVIQKSISRSPG

Top groups

  1. Avatar for RubiscoBobGroup 11. RubiscoBobGroup 1 pt. 10,329
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,930
  3. Avatar for CH4110 Fold it! 13. CH4110 Fold it! 1 pt. 6,883
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 0
  5. Avatar for Firesign 15. Firesign 1 pt. 0
  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 28 pts. 14,056
  2. Avatar for fiendish_ghoul 22. fiendish_ghoul Lv 1 26 pts. 13,905
  3. Avatar for blazegeek 23. blazegeek Lv 1 24 pts. 13,903
  4. Avatar for NPrincipi 24. NPrincipi Lv 1 22 pts. 13,896
  5. Avatar for spmm 25. spmm Lv 1 21 pts. 13,893
  6. Avatar for fpc 26. fpc Lv 1 19 pts. 13,874
  7. Avatar for zippyc137 27. zippyc137 Lv 1 18 pts. 13,829
  8. Avatar for ucad 28. ucad Lv 1 17 pts. 13,740
  9. Avatar for Idiotboy 29. Idiotboy Lv 1 15 pts. 13,717
  10. Avatar for manu8170 30. manu8170 Lv 1 14 pts. 13,710

Comments