Icon representing a puzzle

2209: Electron Density Reconstruction 14

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
ITRTISKAKGPPRIPEVYLLPPPRNELSKKKVSLTCMITGFYPADINVEWDSSEPSDYKNTPPVFDTDGSFFLYSRLKVDTDAWNNGESFTCSVMHEALPNHVIQKSISRSPG

Top groups

  1. Avatar for RubiscoBobGroup 11. RubiscoBobGroup 1 pt. 10,329
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,930
  3. Avatar for CH4110 Fold it! 13. CH4110 Fold it! 1 pt. 6,883
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 0
  5. Avatar for Firesign 15. Firesign 1 pt. 0
  1. Avatar for SemperRabbit 31. SemperRabbit Lv 1 13 pts. 13,690
  2. Avatar for bamh 32. bamh Lv 1 12 pts. 13,623
  3. Avatar for equilibria 33. equilibria Lv 1 11 pts. 13,604
  4. Avatar for Sissue 34. Sissue Lv 1 10 pts. 13,564
  5. Avatar for infjamc 35. infjamc Lv 1 9 pts. 13,560
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 8 pts. 13,416
  7. Avatar for ProfVince 37. ProfVince Lv 1 8 pts. 13,402
  8. Avatar for Crossed Sticks 38. Crossed Sticks Lv 1 7 pts. 13,356
  9. Avatar for stomjoh 39. stomjoh Lv 1 6 pts. 13,139
  10. Avatar for kentish_alex 40. kentish_alex Lv 1 6 pts. 13,037

Comments