Icon representing a puzzle

2209: Electron Density Reconstruction 14

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 29, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
ITRTISKAKGPPRIPEVYLLPPPRNELSKKKVSLTCMITGFYPADINVEWDSSEPSDYKNTPPVFDTDGSFFLYSRLKVDTDAWNNGESFTCSVMHEALPNHVIQKSISRSPG

Top groups


  1. Avatar for RubiscoBobGroup 11. RubiscoBobGroup 1 pt. 10,329
  2. Avatar for Coastal Biochemistry 12. Coastal Biochemistry 1 pt. 8,930
  3. Avatar for CH4110 Fold it! 13. CH4110 Fold it! 1 pt. 6,883
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 0
  5. Avatar for Firesign 15. Firesign 1 pt. 0

  1. Avatar for Deleted player 41. Deleted player 5 pts. 13,013
  2. Avatar for phi16 42. phi16 Lv 1 5 pts. 12,968
  3. Avatar for BarrySampson 43. BarrySampson Lv 1 4 pts. 12,929
  4. Avatar for Grom 44. Grom Lv 1 4 pts. 12,917
  5. Avatar for Merf 45. Merf Lv 1 4 pts. 12,873
  6. Avatar for AlkiP0Ps 46. AlkiP0Ps Lv 1 3 pts. 12,869
  7. Avatar for Joanna_H 47. Joanna_H Lv 1 3 pts. 12,820
  8. Avatar for Arne Heessels 48. Arne Heessels Lv 1 3 pts. 12,795
  9. Avatar for CharaLilith 49. CharaLilith Lv 1 2 pts. 12,677
  10. Avatar for Trajan464 50. Trajan464 Lv 1 2 pts. 12,573

Comments