Icon representing a puzzle

2209: Electron Density Reconstruction 14

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
September 29, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
ITRTISKAKGPPRIPEVYLLPPPRNELSKKKVSLTCMITGFYPADINVEWDSSEPSDYKNTPPVFDTDGSFFLYSRLKVDTDAWNNGESFTCSVMHEALPNHVIQKSISRSPG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 14,431
  3. Avatar for Contenders 3. Contenders 47 pts. 14,304
  4. Avatar for Gargleblasters 4. Gargleblasters 30 pts. 14,080
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 13,893
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 13,874
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 13,710
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 4 pts. 13,416
  9. Avatar for Russian team 9. Russian team 2 pts. 12,917
  10. Avatar for Australia 10. Australia 1 pt. 12,869
  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 14,521
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 14,461
  3. Avatar for LociOiling 3. LociOiling Lv 1 90 pts. 14,426
  4. Avatar for Galaxie 4. Galaxie Lv 1 85 pts. 14,413
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 80 pts. 14,327
  6. Avatar for maithra 6. maithra Lv 1 75 pts. 14,259
  7. Avatar for grogar7 7. grogar7 Lv 1 71 pts. 14,258
  8. Avatar for MicElephant 8. MicElephant Lv 1 67 pts. 14,258
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 63 pts. 14,245
  10. Avatar for Aubade01 10. Aubade01 Lv 1 59 pts. 14,183

Comments