Beginner Puzzle: Easy Mini Freestyle

Closed since over 3 years ago

Summary

• Created: October 06, 2022
• Expires: November 17, 2022 at 23:00 UTC
• Max points: 100

Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

• Sequence: STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

• 1. Go Science 100 pts. 8,307
• 2. UPJ Biochem 25 41 pts. 8,279
• 3. GUGITBIOTECH 14 pts. 7,609
• 4. Coastal Biochemistry 4 pts. 6,489
• 5. Street Smarts 1 pt. 6,264
• 6. baconsbi4u 1 pt. 6,145
• 7. CH4110 Fold it! 1 pt. 6,125

Top evolvers

No scores of this type to display!