Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since over 3 years ago

Beginner

Summary

Created
October 06, 2022
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,307
  2. Avatar for UPJ Biochem 25 2. UPJ Biochem 25 41 pts. 8,279
  3. Avatar for GUGITBIOTECH 3. GUGITBIOTECH 14 pts. 7,609
  4. Avatar for Coastal Biochemistry 4. Coastal Biochemistry 4 pts. 6,489
  5. Avatar for Street Smarts 5. Street Smarts 1 pt. 6,264
  6. Avatar for baconsbi4u 6. baconsbi4u 1 pt. 6,145
  7. Avatar for CH4110 Fold it! 7. CH4110 Fold it! 1 pt. 6,125
  1. Avatar for bredy 101. bredy Lv 1 1 pt. 5,409
  2. Avatar for huangsuxi 102. huangsuxi Lv 1 1 pt. 5,408
  3. Avatar for lis.z 103. lis.z Lv 1 1 pt. 5,382
  4. Avatar for Arendoth 104. Arendoth Lv 1 1 pt. 5,077
  5. Avatar for wenxuemei 105. wenxuemei Lv 1 1 pt. 4,940
  6. Avatar for Po 106. Po Lv 1 1 pt. 2,622
  7. Avatar for Ju Young Oh 107. Ju Young Oh Lv 1 1 pt. 1,634
  8. Avatar for Jaxson Richmond 108. Jaxson Richmond Lv 1 1 pt. 1,041
  9. Avatar for raghuns 109. raghuns Lv 1 1 pt. 0
  10. Avatar for SarahDH 110. SarahDH Lv 1 1 pt. 0

Comments