Icon representing a puzzle

2212: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 10,109
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,831
  3. Avatar for Prime Eye 13. Prime Eye 1 pt. 9,669
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,523
  1. Avatar for MicElephant 11. MicElephant Lv 1 57 pts. 11,420
  2. Avatar for maithra 12. maithra Lv 1 53 pts. 11,396
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 50 pts. 11,391
  4. Avatar for g_b 14. g_b Lv 1 47 pts. 11,390
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 44 pts. 11,366
  6. Avatar for BackBuffer 16. BackBuffer Lv 1 42 pts. 11,345
  7. Avatar for guineapig 17. guineapig Lv 1 39 pts. 11,336
  8. Avatar for Punzi Baker 3 18. Punzi Baker 3 Lv 1 37 pts. 11,331
  9. Avatar for Aubade01 19. Aubade01 Lv 1 34 pts. 11,269
  10. Avatar for stomjoh 20. stomjoh Lv 1 32 pts. 11,211

Comments