Icon representing a puzzle

2212: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 10,109
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,831
  3. Avatar for Prime Eye 13. Prime Eye 1 pt. 9,669
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,523

  1. Avatar for fpc 21. fpc Lv 1 30 pts. 11,191
  2. Avatar for christioanchauvin 22. christioanchauvin Lv 1 28 pts. 11,175
  3. Avatar for drjr 23. drjr Lv 1 26 pts. 11,172
  4. Avatar for Vinara 24. Vinara Lv 1 24 pts. 11,169
  5. Avatar for zippyc137 25. zippyc137 Lv 1 23 pts. 11,167
  6. Avatar for infjamc 26. infjamc Lv 1 21 pts. 11,154
  7. Avatar for blazegeek 27. blazegeek Lv 1 20 pts. 11,147
  8. Avatar for Crossed Sticks 28. Crossed Sticks Lv 1 18 pts. 11,128
  9. Avatar for Bletchley Park 29. Bletchley Park Lv 1 17 pts. 11,121
  10. Avatar for akaaka 30. akaaka Lv 1 16 pts. 11,096

Comments