Icon representing a puzzle

2212: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 10,109
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,831
  3. Avatar for Prime Eye 13. Prime Eye 1 pt. 9,669
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,523
  1. Avatar for BarrySampson 31. BarrySampson Lv 1 14 pts. 11,049
  2. Avatar for NPrincipi 32. NPrincipi Lv 1 13 pts. 11,013
  3. Avatar for bamh 33. bamh Lv 1 12 pts. 11,011
  4. Avatar for fiendish_ghoul 34. fiendish_ghoul Lv 1 11 pts. 10,986
  5. Avatar for heather-1 35. heather-1 Lv 1 10 pts. 10,965
  6. Avatar for alcor29 36. alcor29 Lv 1 10 pts. 10,907
  7. Avatar for ucad 37. ucad Lv 1 9 pts. 10,891
  8. Avatar for equilibria 38. equilibria Lv 1 8 pts. 10,828
  9. Avatar for Merf 39. Merf Lv 1 7 pts. 10,706
  10. Avatar for SemperRabbit 40. SemperRabbit Lv 1 7 pts. 10,681

Comments