Icon representing a puzzle

2212: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 10,109
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,831
  3. Avatar for Prime Eye 13. Prime Eye 1 pt. 9,669
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,523

  1. Avatar for ProfVince 41. ProfVince Lv 1 6 pts. 10,662
  2. Avatar for kentish_alex 42. kentish_alex Lv 1 6 pts. 10,641
  3. Avatar for pizpot 43. pizpot Lv 1 5 pts. 10,560
  4. Avatar for Alistair69 44. Alistair69 Lv 1 5 pts. 10,530
  5. Avatar for AlkiP0Ps 45. AlkiP0Ps Lv 1 4 pts. 10,516
  6. Avatar for rezaefar 46. rezaefar Lv 1 4 pts. 10,510
  7. Avatar for Wiz kid 47. Wiz kid Lv 1 4 pts. 10,460
  8. Avatar for Oransche 48. Oransche Lv 1 3 pts. 10,446
  9. Avatar for hada 49. hada Lv 1 3 pts. 10,440
  10. Avatar for Silvercraft 50. Silvercraft Lv 1 3 pts. 10,424

Comments