Icon representing a puzzle

2212: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 10,109
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,831
  3. Avatar for Prime Eye 13. Prime Eye 1 pt. 9,669
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,523
  1. Avatar for Trajan464 51. Trajan464 Lv 1 2 pts. 10,417
  2. Avatar for Joanna_H 52. Joanna_H Lv 1 2 pts. 10,400
  3. Avatar for hao.guo.cs234 53. hao.guo.cs234 Lv 1 2 pts. 10,338
  4. Avatar for MirsadaH 54. MirsadaH Lv 1 2 pts. 10,320
  5. Avatar for abiogenesis 55. abiogenesis Lv 1 2 pts. 10,291
  6. Avatar for frostschutz 56. frostschutz Lv 1 2 pts. 10,195
  7. Avatar for antibot215 57. antibot215 Lv 1 1 pt. 10,159
  8. Avatar for joshmiller 58. joshmiller Lv 1 1 pt. 10,109
  9. Avatar for Hellcat6 59. Hellcat6 Lv 1 1 pt. 10,092
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 10,037

Comments