Icon representing a puzzle

2212: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 10,109
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,831
  3. Avatar for Prime Eye 13. Prime Eye 1 pt. 9,669
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,523
  1. Avatar for Gonegirl 71. Gonegirl Lv 1 1 pt. 9,919
  2. Avatar for Mohoernchen 72. Mohoernchen Lv 1 1 pt. 9,901
  3. Avatar for heyubob 73. heyubob Lv 1 1 pt. 9,893
  4. Avatar for B. A. Beder 74. B. A. Beder Lv 1 1 pt. 9,863
  5. Avatar for AlphaFold2 75. AlphaFold2 Lv 1 1 pt. 9,831
  6. Avatar for futsall 76. futsall Lv 1 1 pt. 9,820
  7. Avatar for RLSnapdragon 77. RLSnapdragon Lv 1 1 pt. 9,816
  8. Avatar for CharaLilith 78. CharaLilith Lv 1 1 pt. 9,800
  9. Avatar for klum1130 79. klum1130 Lv 1 1 pt. 9,675
  10. Avatar for toxiko 80. toxiko Lv 1 1 pt. 9,672

Comments