Icon representing a puzzle

2212: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 10,109
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,831
  3. Avatar for Prime Eye 13. Prime Eye 1 pt. 9,669
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,523
  1. Avatar for PerplexedPengu 81. PerplexedPengu Lv 1 1 pt. 9,669
  2. Avatar for Mantelmann 82. Mantelmann Lv 1 1 pt. 9,523
  3. Avatar for agcohn821 83. agcohn821 Lv 1 1 pt. 9,056
  4. Avatar for Jay Mehta 84. Jay Mehta Lv 1 1 pt. 8,964
  5. Avatar for jtscott 85. jtscott Lv 1 1 pt. 8,957
  6. Avatar for Deadsloth123 86. Deadsloth123 Lv 1 1 pt. 8,948
  7. Avatar for Deyonna. 87. Deyonna. Lv 1 1 pt. 8,944
  8. Avatar for pondpondeiei 88. pondpondeiei Lv 1 1 pt. 8,940
  9. Avatar for phi16 89. phi16 Lv 1 1 pt. 8,139
  10. Avatar for gavinmc 90. gavinmc Lv 1 1 pt. 8,139

Comments