Icon representing a puzzle

2212: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,944
  2. Avatar for Go Science 2. Go Science 68 pts. 11,587
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 11,530
  4. Avatar for Contenders 4. Contenders 27 pts. 11,420
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 11,391
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 11,191
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 11,175
  8. Avatar for Australia 8. Australia 3 pts. 10,516
  9. Avatar for CS 234 9. CS 234 1 pt. 10,338
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,320
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,944
  2. Avatar for LociOiling 2. LociOiling Lv 1 63 pts. 11,939
  3. Avatar for gmn 3. gmn Lv 1 37 pts. 11,929
  4. Avatar for alcor29 4. alcor29 Lv 1 21 pts. 11,915
  5. Avatar for drjr 5. drjr Lv 1 11 pts. 11,915
  6. Avatar for phi16 6. phi16 Lv 1 5 pts. 11,913
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 2 pts. 11,578
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 1 pt. 11,577
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 1 pt. 11,401
  10. Avatar for maithra 10. maithra Lv 1 1 pt. 11,082

Comments