Icon representing a puzzle

2212: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
October 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,944
  2. Avatar for Go Science 2. Go Science 68 pts. 11,587
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 11,530
  4. Avatar for Contenders 4. Contenders 27 pts. 11,420
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 11,391
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 11,191
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 11,175
  8. Avatar for Australia 8. Australia 3 pts. 10,516
  9. Avatar for CS 234 9. CS 234 1 pt. 10,338
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,320

  1. Avatar for kitsoune 61. kitsoune Lv 1 1 pt. 10,015
  2. Avatar for carxo 62. carxo Lv 1 1 pt. 10,010
  3. Avatar for Larini 63. Larini Lv 1 1 pt. 9,997
  4. Avatar for Dr.Sillem 64. Dr.Sillem Lv 1 1 pt. 9,987
  5. Avatar for kludbrook 65. kludbrook Lv 1 1 pt. 9,985
  6. Avatar for DScott 66. DScott Lv 1 1 pt. 9,981
  7. Avatar for Arne Heessels 67. Arne Heessels Lv 1 1 pt. 9,979
  8. Avatar for zbp 68. zbp Lv 1 1 pt. 9,948
  9. Avatar for RichGuilmain 69. RichGuilmain Lv 1 1 pt. 9,945
  10. Avatar for ChickenRocks432 70. ChickenRocks432 Lv 1 1 pt. 9,938

Comments