Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for RubiscoBobGroup 11. RubiscoBobGroup 1 pt. 9,942
  2. Avatar for Team China 12. Team China 1 pt. 9,752
  3. Avatar for Window Group 13. Window Group 1 pt. 7,735
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,648
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 95 pts. 11,542
  3. Avatar for Galaxie 3. Galaxie Lv 1 90 pts. 11,460
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 85 pts. 11,436
  5. Avatar for guineapig 5. guineapig Lv 1 80 pts. 11,407
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 75 pts. 11,406
  7. Avatar for Idiotboy 7. Idiotboy Lv 1 71 pts. 11,394
  8. Avatar for drjr 8. drjr Lv 1 67 pts. 11,349
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 63 pts. 11,323
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 59 pts. 11,313

Comments