Icon representing a puzzle

2215: Revisiting Puzzle 52: Bacteria Energy

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,648
  2. Avatar for Go Science 2. Go Science 65 pts. 11,543
  3. Avatar for Contenders 3. Contenders 41 pts. 11,407
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,310
  5. Avatar for Gargleblasters 5. Gargleblasters 14 pts. 11,289
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 11,124
  7. Avatar for Firesign 7. Firesign 4 pts. 10,968
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 10,907
  9. Avatar for Australia 9. Australia 1 pt. 10,436
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 10,256

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,646
  2. Avatar for LociOiling 2. LociOiling Lv 1 52 pts. 11,644
  3. Avatar for phi16 3. phi16 Lv 1 24 pts. 11,628
  4. Avatar for gmn 4. gmn Lv 1 10 pts. 11,619
  5. Avatar for drjr 5. drjr Lv 1 4 pts. 11,612
  6. Avatar for alcor29 6. alcor29 Lv 1 1 pt. 11,608
  7. Avatar for Sandrix72 7. Sandrix72 Lv 1 1 pt. 11,543
  8. Avatar for fpc 8. fpc Lv 1 1 pt. 11,310
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 1 pt. 11,113

Comments