Placeholder image of a protein
Icon representing a puzzle

2221: Electron Density Reconstruction 15

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
November 01, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
VESSTDGQVVPQEVLNLPLEKAHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 19,945
  2. Avatar for Australia 12. Australia 1 pt. 19,527
  3. Avatar for CureCoin 13. CureCoin 1 pt. 18,942
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 18,942
  5. Avatar for Gargleblasters 15. Gargleblasters 1 pt. 18,667
  6. Avatar for RubiscoBobGroup 16. RubiscoBobGroup 1 pt. 16,455
  7. Avatar for VCE Biology_NCB 17. VCE Biology_NCB 1 pt. 8,843

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 21,032
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 60 pts. 21,027
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 33 pts. 21,018
  4. Avatar for Phyx 4. Phyx Lv 1 17 pts. 21,014
  5. Avatar for LociOiling 5. LociOiling Lv 1 8 pts. 20,986
  6. Avatar for gmn 6. gmn Lv 1 4 pts. 20,979
  7. Avatar for alcor29 7. alcor29 Lv 1 2 pts. 20,959
  8. Avatar for fpc 8. fpc Lv 1 1 pt. 20,854
  9. Avatar for maithra 9. maithra Lv 1 1 pt. 20,820
  10. Avatar for Oransche 10. Oransche Lv 1 1 pt. 20,808

Comments