Placeholder image of a protein
Icon representing a puzzle

2224: Electron Density Reconstruction 16

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 09, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 24,572
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 23,262
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 23,244
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 22,826
  5. Avatar for Gargleblasters 15. Gargleblasters 1 pt. 20,181
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 27,428
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 27,426
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 88 pts. 27,422
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 83 pts. 27,345
  5. Avatar for guineapig 5. guineapig Lv 1 77 pts. 27,270
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 72 pts. 27,218
  7. Avatar for Phyx 7. Phyx Lv 1 68 pts. 27,216
  8. Avatar for drjr 8. drjr Lv 1 63 pts. 27,205
  9. Avatar for bamh 9. bamh Lv 1 59 pts. 27,190
  10. Avatar for grogar7 10. grogar7 Lv 1 55 pts. 27,152

Comments