Placeholder image of a protein
Icon representing a puzzle

2224: Electron Density Reconstruction 16

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 09, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 27,456
  2. Avatar for Go Science 2. Go Science 70 pts. 27,422
  3. Avatar for Contenders 3. Contenders 47 pts. 27,341
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 26,979
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 26,546
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 26,517
  7. Avatar for Hold My Beer 7. Hold My Beer 7 pts. 26,194
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 26,136
  9. Avatar for VeFold 9. VeFold 2 pts. 25,509
  10. Avatar for Australia 10. Australia 1 pt. 24,750
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 27,456
  2. Avatar for gmn 2. gmn Lv 1 70 pts. 27,441
  3. Avatar for LociOiling 3. LociOiling Lv 1 47 pts. 27,428
  4. Avatar for alcor29 4. alcor29 Lv 1 30 pts. 27,392
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 19 pts. 27,388
  6. Avatar for silent gene 6. silent gene Lv 1 11 pts. 27,386
  7. Avatar for Phyx 7. Phyx Lv 1 7 pts. 27,386
  8. Avatar for MicElephant 8. MicElephant Lv 1 4 pts. 27,341
  9. Avatar for guineapig 9. guineapig Lv 1 2 pts. 27,273
  10. Avatar for kyoota 10. kyoota Lv 1 1 pt. 27,218

Comments