Placeholder image of a protein
Icon representing a puzzle

2224: Electron Density Reconstruction 16

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
November 09, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 27,456
  2. Avatar for Go Science 2. Go Science 70 pts. 27,422
  3. Avatar for Contenders 3. Contenders 47 pts. 27,341
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 26,979
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 26,546
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 26,517
  7. Avatar for Hold My Beer 7. Hold My Beer 7 pts. 26,194
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 26,136
  9. Avatar for VeFold 9. VeFold 2 pts. 25,509
  10. Avatar for Australia 10. Australia 1 pt. 24,750

  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 51 pts. 27,138
  2. Avatar for maithra 12. maithra Lv 1 47 pts. 27,125
  3. Avatar for gmn 13. gmn Lv 1 44 pts. 27,060
  4. Avatar for MicElephant 14. MicElephant Lv 1 41 pts. 27,015
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 38 pts. 27,003
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 35 pts. 26,979
  7. Avatar for silent gene 17. silent gene Lv 1 32 pts. 26,972
  8. Avatar for ZeroLeak7 18. ZeroLeak7 Lv 1 30 pts. 26,956
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 27 pts. 26,872
  10. Avatar for SemperRabbit 20. SemperRabbit Lv 1 25 pts. 26,741

Comments