Placeholder image of a protein
Icon representing a puzzle

2224: Electron Density Reconstruction 16

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
November 09, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 27,456
  2. Avatar for Go Science 2. Go Science 70 pts. 27,422
  3. Avatar for Contenders 3. Contenders 47 pts. 27,341
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 26,979
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 26,546
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 26,517
  7. Avatar for Hold My Beer 7. Hold My Beer 7 pts. 26,194
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 26,136
  9. Avatar for VeFold 9. VeFold 2 pts. 25,509
  10. Avatar for Australia 10. Australia 1 pt. 24,750

  1. Avatar for alcor29 21. alcor29 Lv 1 23 pts. 26,707
  2. Avatar for zippyc137 22. zippyc137 Lv 1 21 pts. 26,691
  3. Avatar for BackBuffer 23. BackBuffer Lv 1 20 pts. 26,619
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 18 pts. 26,546
  5. Avatar for blazegeek 25. blazegeek Lv 1 16 pts. 26,529
  6. Avatar for BootsMcGraw 26. BootsMcGraw Lv 1 15 pts. 26,435
  7. Avatar for Idiotboy 27. Idiotboy Lv 1 14 pts. 26,429
  8. Avatar for Steven Pletsch 28. Steven Pletsch Lv 1 12 pts. 26,194
  9. Avatar for ShadowTactics 29. ShadowTactics Lv 1 11 pts. 26,136
  10. Avatar for akaaka 30. akaaka Lv 1 10 pts. 26,004

Comments