Placeholder image of a protein
Icon representing a puzzle

2224: Electron Density Reconstruction 16

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
November 09, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 27,456
  2. Avatar for Go Science 2. Go Science 70 pts. 27,422
  3. Avatar for Contenders 3. Contenders 47 pts. 27,341
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 26,979
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 26,546
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 26,517
  7. Avatar for Hold My Beer 7. Hold My Beer 7 pts. 26,194
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 26,136
  9. Avatar for VeFold 9. VeFold 2 pts. 25,509
  10. Avatar for Australia 10. Australia 1 pt. 24,750

  1. Avatar for Gonegirl 41. Gonegirl Lv 1 3 pts. 25,375
  2. Avatar for rezaefar 42. rezaefar Lv 1 3 pts. 25,367
  3. Avatar for Merf 43. Merf Lv 1 3 pts. 25,339
  4. Avatar for NPrincipi 44. NPrincipi Lv 1 2 pts. 25,218
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 2 pts. 25,145
  6. Avatar for ProfVince 46. ProfVince Lv 1 2 pts. 25,087
  7. Avatar for ucad 47. ucad Lv 1 2 pts. 25,043
  8. Avatar for Oransche 48. Oransche Lv 1 1 pt. 25,018
  9. Avatar for Alistair69 49. Alistair69 Lv 1 1 pt. 24,814
  10. Avatar for AlkiP0Ps 50. AlkiP0Ps Lv 1 1 pt. 24,750

Comments