Placeholder image of a protein
Icon representing a puzzle

2224: Electron Density Reconstruction 16

Closed since over 3 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary


Created
November 09, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 27,456
  2. Avatar for Go Science 2. Go Science 70 pts. 27,422
  3. Avatar for Contenders 3. Contenders 47 pts. 27,341
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 26,979
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 26,546
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 26,517
  7. Avatar for Hold My Beer 7. Hold My Beer 7 pts. 26,194
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 26,136
  9. Avatar for VeFold 9. VeFold 2 pts. 25,509
  10. Avatar for Australia 10. Australia 1 pt. 24,750

  1. Avatar for Crossed Sticks 51. Crossed Sticks Lv 1 1 pt. 24,640
  2. Avatar for AlphaFold2 52. AlphaFold2 Lv 1 1 pt. 24,572
  3. Avatar for kyoota 53. kyoota Lv 1 1 pt. 24,499
  4. Avatar for Sporeo 54. Sporeo Lv 1 1 pt. 24,490
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 24,314
  6. Avatar for Wiz kid 56. Wiz kid Lv 1 1 pt. 24,267
  7. Avatar for Hellcat6 57. Hellcat6 Lv 1 1 pt. 24,222
  8. Avatar for sallallami 58. sallallami Lv 1 1 pt. 24,118
  9. Avatar for Dr.Sillem 59. Dr.Sillem Lv 1 1 pt. 23,867
  10. Avatar for Mohoernchen 60. Mohoernchen Lv 1 1 pt. 23,581

Comments