Placeholder image of a protein
Icon representing a puzzle

2224: Electron Density Reconstruction 16

Closed since over 3 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary


Created
November 09, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 27,456
  2. Avatar for Go Science 2. Go Science 70 pts. 27,422
  3. Avatar for Contenders 3. Contenders 47 pts. 27,341
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 26,979
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 26,546
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 26,517
  7. Avatar for Hold My Beer 7. Hold My Beer 7 pts. 26,194
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 26,136
  9. Avatar for VeFold 9. VeFold 2 pts. 25,509
  10. Avatar for Australia 10. Australia 1 pt. 24,750

  1. Avatar for BrittanyBird 61. BrittanyBird Lv 1 1 pt. 23,503
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 23,432
  3. Avatar for futsall 63. futsall Lv 1 1 pt. 23,418
  4. Avatar for pruneau_44 64. pruneau_44 Lv 1 1 pt. 23,351
  5. Avatar for alyssa_d_V2.0 65. alyssa_d_V2.0 Lv 1 1 pt. 23,262
  6. Avatar for Savas 66. Savas Lv 1 1 pt. 23,244
  7. Avatar for slashthedragon 67. slashthedragon Lv 1 1 pt. 23,212
  8. Avatar for changliang 68. changliang Lv 1 1 pt. 23,158
  9. Avatar for vyndaquel 69. vyndaquel Lv 1 1 pt. 23,114
  10. Avatar for furi0us 70. furi0us Lv 1 1 pt. 23,056

Comments