Foldit

2227: Electron Density Reconstruction 17

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created: November 15, 2022
Expires: November 24, 2022 at 18:00 UTC
Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence: VMGKRYVATPQQSQWEMVVNTPLECQLVHPIPSFGDAVFSSRANKKINLDFELKMRRPMGETRNVSLISMPPPWRPGEHADRITNLKFFKQFDGYVGGQTAWGILSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQNKYNAFSDCISNLLKYSFEDIAFTILHYERQGDQLTKASKKRLSQIADYIRHNQDIDLVLVATYTDSTDGKSASQSLSERRAESLRDYFQSLGLPEDRIQVQGYGKRRPIADNGSPIGKDKNRRVVISLGRTQVHHHHHH

Top groups

11. Australia 1 pt. 30,800
12. AlphaFold 1 pt. 30,670
13. Trinity Biology 1 pt. 27,470
14. Coastal Biochemistry 1 pt. 24,603
15. Italiani Al Lavoro 1 pt. 24,164
16. Foldit Staff 1 pt. 0

1. LociOiling Lv 1
100 pts. 33,828
2. Galaxie Lv 1 65 pts. 33,798
3. Bruno Kestemont Lv 1 41 pts. 33,692
4. phi16 Lv 1 24 pts. 33,676
5. alcor29 Lv 1 14 pts. 33,634
6. gmn Lv 1 7 pts. 33,591
7. BootsMcGraw Lv 1 4 pts. 33,210
8. Pikamander2 Lv 1 2 pts. 33,196
9. Phyx Lv 1 1 pt. 32,911
10. equilibria Lv 1 1 pt. 32,775

Comments

BootsMcGraw Lv 1

November 24, 2022

Contenders was cheated out of rank #3 for this puzzle. I had an evolver score high enough to bring us to rank #3, but the game never registered my score. Proof, below.

https://ibb.co/0GNy4qS

LociOiling Lv 1

May 24, 2025

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC 1
2227: Electron Density Reconstruction 17
2  puckers found!
pucker 1 (ideality), segments 202-203 (protein), distance = 8.662, ideality = -29070.721, -29069.032
pucker 2 (ideality), segments 236-237 (protein), distance = 12.855, ideality = -66704.216, -66709.765