Placeholder image of a protein
Icon representing a puzzle

2227: Electron Density Reconstruction 17

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
November 15, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
VMGKRYVATPQQSQWEMVVNTPLECQLVHPIPSFGDAVFSSRANKKINLDFELKMRRPMGETRNVSLISMPPPWRPGEHADRITNLKFFKQFDGYVGGQTAWGILSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQNKYNAFSDCISNLLKYSFEDIAFTILHYERQGDQLTKASKKRLSQIADYIRHNQDIDLVLVATYTDSTDGKSASQSLSERRAESLRDYFQSLGLPEDRIQVQGYGKRRPIADNGSPIGKDKNRRVVISLGRTQVHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 33,828
  2. Avatar for Go Science 2. Go Science 71 pts. 33,692
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 33,218
  4. Avatar for Contenders 4. Contenders 33 pts. 33,210
  5. Avatar for Hold My Beer 5. Hold My Beer 22 pts. 32,799
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 32,708
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 32,447
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 32,249
  9. Avatar for VeFold 9. VeFold 3 pts. 32,161
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 32,084

  1. Avatar for fpc 11. fpc Lv 1 1 pt. 32,708
  2. Avatar for maithra 12. maithra Lv 1 1 pt. 32,482
  3. Avatar for Oransche 13. Oransche Lv 1 1 pt. 32,194

Comments


LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC 1
2227: Electron Density Reconstruction 17
2  puckers found!
pucker 1 (ideality), segments 202-203 (protein), distance = 8.662, ideality = -29070.721, -29069.032
pucker 2 (ideality), segments 236-237 (protein), distance = 12.855, ideality = -66704.216, -66709.765