Placeholder image of a protein
Icon representing a puzzle

2227: Electron Density Reconstruction 17

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 15, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
VMGKRYVATPQQSQWEMVVNTPLECQLVHPIPSFGDAVFSSRANKKINLDFELKMRRPMGETRNVSLISMPPPWRPGEHADRITNLKFFKQFDGYVGGQTAWGILSELEKGRYPTFSYQDWQSRDQRIEVALSSVLFQNKYNAFSDCISNLLKYSFEDIAFTILHYERQGDQLTKASKKRLSQIADYIRHNQDIDLVLVATYTDSTDGKSASQSLSERRAESLRDYFQSLGLPEDRIQVQGYGKRRPIADNGSPIGKDKNRRVVISLGRTQVHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 33,828
  2. Avatar for Go Science 2. Go Science 71 pts. 33,692
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 33,218
  4. Avatar for Contenders 4. Contenders 33 pts. 33,210
  5. Avatar for Hold My Beer 5. Hold My Beer 22 pts. 32,799
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 32,708
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 32,447
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 5 pts. 32,249
  9. Avatar for VeFold 9. VeFold 3 pts. 32,161
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 32,084
  1. Avatar for manu8170 31. manu8170 Lv 1 10 pts. 31,964
  2. Avatar for NPrincipi 32. NPrincipi Lv 1 9 pts. 31,934
  3. Avatar for ProfVince 33. ProfVince Lv 1 8 pts. 31,716
  4. Avatar for Alistair69 34. Alistair69 Lv 1 7 pts. 31,712
  5. Avatar for phi16 35. phi16 Lv 1 6 pts. 31,665
  6. Avatar for alcor29 36. alcor29 Lv 1 6 pts. 31,557
  7. Avatar for Trajan464 37. Trajan464 Lv 1 5 pts. 31,509
  8. Avatar for CharaLilith 38. CharaLilith Lv 1 5 pts. 31,248
  9. Avatar for ZeroLeak7 39. ZeroLeak7 Lv 1 4 pts. 31,223
  10. Avatar for blazegeek 40. blazegeek Lv 1 4 pts. 31,209

Comments

LociOiling Lv 1

This puzzle was puckered due to missing residues.

The recipe Pucker Picker 3.0 RC 1 detected these puckers:

Pucker Picker 3.0 RC 1
2227: Electron Density Reconstruction 17
2  puckers found!
pucker 1 (ideality), segments 202-203 (protein), distance = 8.662, ideality = -29070.721, -29069.032
pucker 2 (ideality), segments 236-237 (protein), distance = 12.855, ideality = -66704.216, -66709.765