Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 7,700
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,435
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 6,080
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 0
  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 56 pts. 10,481
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 53 pts. 10,479
  3. Avatar for gmn 13. gmn Lv 1 50 pts. 10,446
  4. Avatar for manu8170 14. manu8170 Lv 1 47 pts. 10,437
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 44 pts. 10,400
  6. Avatar for guineapig 16. guineapig Lv 1 41 pts. 10,398
  7. Avatar for MicElephant 17. MicElephant Lv 1 39 pts. 10,383
  8. Avatar for alcor29 18. alcor29 Lv 1 36 pts. 10,380
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 34 pts. 10,374
  10. Avatar for fpc 20. fpc Lv 1 32 pts. 10,349

Comments