Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 7,700
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,435
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 6,080
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 0
  1. Avatar for infjamc 31. infjamc Lv 1 14 pts. 10,029
  2. Avatar for zippyc137 32. zippyc137 Lv 1 13 pts. 9,978
  3. Avatar for NPrincipi 33. NPrincipi Lv 1 12 pts. 9,908
  4. Avatar for blazegeek 34. blazegeek Lv 1 11 pts. 9,843
  5. Avatar for AlkiP0Ps 35. AlkiP0Ps Lv 1 10 pts. 9,816
  6. Avatar for ProfVince 36. ProfVince Lv 1 9 pts. 9,809
  7. Avatar for BarrySampson 37. BarrySampson Lv 1 9 pts. 9,763
  8. Avatar for kentish_alex 38. kentish_alex Lv 1 8 pts. 9,630
  9. Avatar for georg137 39. georg137 Lv 1 7 pts. 9,620
  10. Avatar for AlphaFold2 40. AlphaFold2 Lv 1 7 pts. 9,543

Comments