Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 7,700
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,435
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 6,080
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 0
  1. Avatar for ShadowTactics 51. ShadowTactics Lv 1 2 pts. 9,062
  2. Avatar for carxo 52. carxo Lv 1 2 pts. 9,028
  3. Avatar for Trajan464 53. Trajan464 Lv 1 2 pts. 8,925
  4. Avatar for Arne Heessels 54. Arne Heessels Lv 1 2 pts. 8,909
  5. Avatar for BackBuffer 55. BackBuffer Lv 1 2 pts. 8,874
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 8,676
  7. Avatar for vyndaquel 57. vyndaquel Lv 1 1 pt. 8,598
  8. Avatar for Gonegirl 58. Gonegirl Lv 1 1 pt. 8,510
  9. Avatar for rezaefar 59. rezaefar Lv 1 1 pt. 8,494
  10. Avatar for heyubob 60. heyubob Lv 1 1 pt. 8,490

Comments