Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 7,700
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,435
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 6,080
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 0
  1. Avatar for aniri 61. aniri Lv 1 1 pt. 8,349
  2. Avatar for phd.fun 62. phd.fun Lv 1 1 pt. 8,208
  3. Avatar for Joanna_H 63. Joanna_H Lv 1 1 pt. 8,156
  4. Avatar for Pibeagles1 64. Pibeagles1 Lv 1 1 pt. 8,126
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 8,111
  6. Avatar for RichGuilmain 66. RichGuilmain Lv 1 1 pt. 7,970
  7. Avatar for Wiz kid 67. Wiz kid Lv 1 1 pt. 7,851
  8. Avatar for pruneau_44 68. pruneau_44 Lv 1 1 pt. 7,716
  9. Avatar for Steven Pletsch 69. Steven Pletsch Lv 1 1 pt. 7,700
  10. Avatar for Crossed Sticks 70. Crossed Sticks Lv 1 1 pt. 7,690

Comments