Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 7,700
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,435
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 6,080
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 0

  1. Avatar for pizpot 71. pizpot Lv 1 1 pt. 7,650
  2. Avatar for levels 72. levels Lv 1 1 pt. 7,607
  3. Avatar for Oransche 73. Oransche Lv 1 1 pt. 7,604
  4. Avatar for Mohoernchen 74. Mohoernchen Lv 1 1 pt. 7,602
  5. Avatar for Swapper242 75. Swapper242 Lv 1 1 pt. 7,495
  6. Avatar for Amylase2.0 76. Amylase2.0 Lv 1 1 pt. 7,447
  7. Avatar for izzgood 77. izzgood Lv 1 1 pt. 7,435
  8. Avatar for slyscorpion 78. slyscorpion Lv 1 1 pt. 7,383
  9. Avatar for Ju Young Oh 79. Ju Young Oh Lv 1 1 pt. 7,373
  10. Avatar for klbklb 80. klbklb Lv 1 1 pt. 7,355

Comments