Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,779
  2. Avatar for Go Science 2. Go Science 68 pts. 10,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,437
  4. Avatar for Contenders 4. Contenders 27 pts. 10,400
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,349
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,166
  7. Avatar for Australia 7. Australia 5 pts. 9,816
  8. Avatar for AlphaFold 8. AlphaFold 3 pts. 9,543
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,062
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 8,490
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,775
  2. Avatar for LociOiling 2. LociOiling Lv 1 47 pts. 10,774
  3. Avatar for SemperRabbit 3. SemperRabbit Lv 1 19 pts. 10,769
  4. Avatar for gmn 4. gmn Lv 1 7 pts. 10,758
  5. Avatar for phi16 5. phi16 Lv 1 2 pts. 10,757
  6. Avatar for alcor29 6. alcor29 Lv 1 1 pt. 10,747
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 1 pt. 10,584
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 1 pt. 10,212

Comments