Icon representing a puzzle

2230: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 22, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,779
  2. Avatar for Go Science 2. Go Science 68 pts. 10,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,437
  4. Avatar for Contenders 4. Contenders 27 pts. 10,400
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 10,349
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 10,166
  7. Avatar for Australia 7. Australia 5 pts. 9,816
  8. Avatar for AlphaFold 8. AlphaFold 3 pts. 9,543
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,062
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 8,490

  1. Avatar for sallallami
    1. sallallami Lv 1
    100 pts. 10,815
  2. Avatar for LociOiling 2. LociOiling Lv 1 95 pts. 10,779
  3. Avatar for phi16 3. phi16 Lv 1 90 pts. 10,693
  4. Avatar for fiendish_ghoul 4. fiendish_ghoul Lv 1 85 pts. 10,588
  5. Avatar for SemperRabbit 5. SemperRabbit Lv 1 80 pts. 10,572
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 76 pts. 10,572
  7. Avatar for Idiotboy 7. Idiotboy Lv 1 72 pts. 10,559
  8. Avatar for Aubade01 8. Aubade01 Lv 1 68 pts. 10,552
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 64 pts. 10,548
  10. Avatar for Galaxie 10. Galaxie Lv 1 60 pts. 10,509

Comments