Icon representing a puzzle

2233: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
December 01, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 8,601
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 7,628
  3. Avatar for Window Group 13. Window Group 1 pt. 0

  1. Avatar for sallallami
    1. sallallami Lv 1
    100 pts. 10,746
  2. Avatar for LociOiling 2. LociOiling Lv 1 95 pts. 10,671
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 90 pts. 10,533
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 85 pts. 10,480
  5. Avatar for gmn 5. gmn Lv 1 81 pts. 10,449
  6. Avatar for MicElephant 6. MicElephant Lv 1 76 pts. 10,443
  7. Avatar for Sandrix72 7. Sandrix72 Lv 1 72 pts. 10,428
  8. Avatar for Aubade01 8. Aubade01 Lv 1 68 pts. 10,414
  9. Avatar for Galaxie 9. Galaxie Lv 1 64 pts. 10,346
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 61 pts. 10,322

Comments