Icon representing a puzzle

2233: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
December 01, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,671
  2. Avatar for Go Science 2. Go Science 65 pts. 10,534
  3. Avatar for Contenders 3. Contenders 41 pts. 10,443
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 24 pts. 10,084
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,010
  6. Avatar for Australia 6. Australia 7 pts. 9,997
  7. Avatar for Gargleblasters 7. Gargleblasters 4 pts. 9,847
  8. Avatar for Marvin's bunch 8. Marvin's bunch 2 pts. 9,839
  9. Avatar for Hold My Beer 9. Hold My Beer 1 pt. 9,763
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 9,270

  1. Avatar for Davidoski 81. Davidoski Lv 1 1 pt. 7,811
  2. Avatar for NickMihal 82. NickMihal Lv 1 1 pt. 7,809
  3. Avatar for heyubob 83. heyubob Lv 1 1 pt. 7,797
  4. Avatar for Jimmy1234! 84. Jimmy1234! Lv 1 1 pt. 7,792
  5. Avatar for izzgood 85. izzgood Lv 1 1 pt. 7,628
  6. Avatar for drjr 86. drjr Lv 1 1 pt. 7,279
  7. Avatar for elherzog 87. elherzog Lv 1 1 pt. 6,840
  8. Avatar for fiendish_ghoul 88. fiendish_ghoul Lv 1 1 pt. 5,618
  9. Avatar for Phyx 89. Phyx Lv 1 1 pt. 4,273
  10. Avatar for mikrokosam 90. mikrokosam Lv 1 1 pt. 1,750

Comments