Icon representing a puzzle

2243: Revisiting Puzzle 60: Beta Barrel

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
December 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 11,274
  2. Avatar for Australia 12. Australia 1 pt. 11,268
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 11,246
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 11,131

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,881
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 94 pts. 12,733
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 88 pts. 12,556
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 82 pts. 12,521
  5. Avatar for Idiotboy 5. Idiotboy Lv 1 77 pts. 12,507
  6. Avatar for maithra 6. maithra Lv 1 72 pts. 12,503
  7. Avatar for WBarme1234 7. WBarme1234 Lv 1 67 pts. 12,458
  8. Avatar for gmn 8. gmn Lv 1 63 pts. 12,392
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 58 pts. 12,292
  10. Avatar for akaaka 10. akaaka Lv 1 54 pts. 12,246

Comments